ELF @44 44@4@ÀÀôô@ô@p@@@@`3`3@c8  @ @$ $ /lib/ld-uClibc.so.0²`–Õ D @ `Ö@¸@@Ø@ < pPpppp@ ppCppCC.' 5%4 1  !*0;,& 8$ 2(6:3#"7+9)-/?=>A<B@ ß`–ñÿºñÿè @ñÿ`–ñÿ À @ËP %dñÿÏ@Ädñÿñpñÿ78ñÿ1dñÿ\@Ö@€"Â0Ö@ì Ö@D;Ö@|OÖ@HÍðÕ@TzàÕ@ìiÐÕ@eÀÕ@ °Õ@$€TÌ@TyÌ@Tl Õ@ì…Õ@¤•ä,  Vñ€Õ@d5`Ö@ §t@ÀrpÕ@Dù`Õ@$@PÕ@Ú@Õ@@&0Õ@T3 Õ@ Õ@P‡Õ@ÐðÔ@TáàÔ@h9ÐÔ@èŒ4@ "]ÀÔ@\’°Ô@P/D @  Ô@ì,Ô@4é€Ô@@OpÔ@˜¬`Ô@P @ä´PÔ@´G@Ô@0È0Ô@(b Ô@¤Ô@ü°  »™Ô@pVðÓ@pàÓ@<ÒÐÓ@ø__deregister_frame_info__register_frame_info_init_fini__uClibc_start_mainstrlenstderrfprintffwritefputcstrcmpwl_getwl_setstrcasecmpstrtolprintfstrncasecmpstrtoulmallocstdoutfputsputsatoiputcharmemsetstrncmpisspacesprintfisprintstrchrstrncpymemcmpstrcpyisdigitfopenfflushfreadferrorfclosetolowersocketioctlcloseperror__errno_locationexitfgetsstrsepwl_checkwl_cmdscmd_usagewl_usagewl_varcmd_DYNAMIC_LINKING__RLD_MAPlibc.so.0_gp_disp_DYNAMIC_GLOBAL_OFFSET_TABLE_main_ftext_fdata_gp_edata__bss_start_fbss_endÁ<Œœ'!à™àÿ½'¼¯¿¯¼¯€™X 9' ø ¼ €™ÐÒ9' ø ¼¿ ½'àÁ< ‹œ'!à™Øÿ½'¼¯ ¿¯¾¯¼¯!𠀂B$BŒ@=€‚B$BŒBŒ@€‚B$BŒB$€!$"¬€‚B$BŒüÿB$BŒ!È@ ø ¼Ûÿ°€‚ @€„T„$°€™ ø ¼$€!$"¬!èÀ ¿¾(½'àÁ< D €„¨„$E¢“‚D €FF!FDDô€™ ø ¼£“ €„Ä„$ƒD €FF!FDDô€™ ø ¼£“ €„à„$ƒD €FF!FDDô€™ ø ¼£“ €„„$ƒD €FF!FDDô€™ ø ¼!(¿ °0´Ç4µÇ8½'àÀ<Ø7œ'!à™Èþ½'¼¯,³¯(²¯4¿¯0¼¯$±¯ °¯¥Œ²'@$!0@$¢¯`€™ ø ¼!˜@,` €„ „$ô€™ ø ¼¢@!ˆ°'Ž €„0„$ô€™ ø ¼CŽ1&+#&ñÿ` €„¤„$à€™ ø ¼!`4¿,³(²$± °8½'àÀ< 6œ'!à™Èÿ½'¼¯±¯!ˆÀ(´¯$³¯ ²¯0¿¯,¼¯°¯1&€’R& $0ŽB® @®! €Ÿ!˜ ! D€™ ø ¼þÿB$B,@!( €„4„$ô€™ ø ¼ÿÿ$0¿(´$³ ²±°8½'àD&ü€™ ø ¼0Žf!  €…P¥$œ€™ ø ¼V@!  €…`¥$œ€™ ø ¼@!( €„T„$Çÿ$B®eŽ€&€‡ç$çŒ! €!0`€™ ø ¼!˜@¸ÿ` €„ „$ô€™ ø ¼ CŽ`!ˆ&Ž €„0„$ô€™ ø ¼ CŽ1&+#&ñÿ` €„¤„$à€™ ø ¼Œÿ!`$½ÿ €„l„$à€™ ø ¼ÿÿ${ÿ €„|„$à€™ ø ¼ÿÿ$nÿÀ<”3œ'!à™Ðÿ½'¼¯ °¯!à!€À®(¿¯$¼¯`€™ ø ¼!@ `Ž!@Ž €…h¥$!0@–ÿB$B,j$@p€„„Œk$¢¯´€™ ø ¼®®!(¿ °0½'à®®öÿÀ<œ2œ'!à™ÿ½'¼¯$¦'$ز¯Ð°¯à¿¯Ü¼¯Ô±¯!€`€™ ø ¼!€@C! @ €„”„$ô€™ ø ¼ ¦'! @$$$`€™ ø ¼!€@$¥'!H°' ¦! €™¼;9' ø ¼ €„¼„$!(ô€™ ø ¼!à¿Ø²Ô±Ð°è½'à $™ ø ¼ðÿ!€‘1& $ˆ$!0  $"®`€™ ø ¼!€@Þÿ€ƒc$cŒj$$&b#Žk$Ïÿb€™hQ9' ø ¼Åÿ!! €™DW9' ø ¼¹ÿ!À<\0œ'!à™Àÿ½'¼¯(°¯!€À4³¯0²¯,±¯<¿¯8¼¯&Ž±'!€!˜ ! @>@!( €™:9' ø ¼ €„È„$2@!(Ž!0! @$@! @Ѐ™ ø ¼ eŽ! @¦' $¢¯\€™ ø ¼<¿4³0²,±(°@½'à!0 $\€™ ø ¼îÿ €„ä„$à€™ ø ¼ÿÿ$áÿÀ<ä.œ'!à™°ÿ½'¼¯(²¯!ÀD¾¯<·¯H¿¯@¼¯8¶¯4µ¯0´¯,³¯$±¯ °¯R&BŽ!¸ w@!ð€D€X€™ ø ¼$M@DŽ!(!0Ѐ™ ø ¼¢¯! @€‚€B$BŒD!€&.À @€‚€B$!CBŒóÿD!˜`! ÀEŽ €„ „$ô€™ ø ¼!`H¿D¾<·8¶4µ0´,³(²$± °P½'à 厦'$\€™ ø ¼çÿ!˜@€–€Ö&µ!€Ñ&.À &@$ŽEŽœ€™ ø ¼1&ðÿ@!ÔUŒ!˜µ¯»ÿ厦'$`€™ ø ¼!˜@¼ÿ`€ƒ€c$bŒ¦ €…D¥$!F!€&.€„€„$À @€‚€B$!CBŒðÿF!ƒEŒ €„L„$ô€™ ø ¼‘ÿ!`eŒòÿÀ<Ä+œ'!à™Àÿ½'¼¯0´¯,³¯ °¯8¿¯4¼¯(²¯$±¯!˜ eŽ!€À$¦'! €`€™ ø ¼!@&<`Žì dŽ €…xè¥$œ€™ ø ¼Q@dŽ €…$é¥$œ€™ ø ¼³@dŽ €…Üé¥$œ€™ ø ¼@ eŽ! €¦'$\€™ ø ¼Â `!`8¿0´,³(²$± °@½'àõÿ!ûÿ$ãÿ ±Ž €…ø ¥$œ€™ ø ¼u@Ž €…d¥$œ€™ ø ¼h@Ž €…ü ¥$œ€™ ø ¼W@Ž €…$¥$œ€™ ø ¼J@Ž €…h¥$œ€™ ø ¼9@Ž €…l¥$œ€™ ø ¼,@Ž €…x¥$œ€™ ø ¼÷ÿ$@! Ž €…|¥$œ€™ ø ¼÷ÿ$ @! &Ž’ÿ@±¯nÿ$ˆ"ôÿ16ðÿ$ˆ2ìÿ16èÿ[ÿ ýÿ$Ž €…ø ¥$œ€™ ø ¼{@Ž €…d¥$œ€™ ø ¼n@Ž €…ü ¥$œ€™ ø ¼Z@Ž €…$¥$œ€™ ø ¼M@Ž €…h¥$œ€™ ø ¼9@Ž €…l¥$œ€™ ø ¼,@Ž €…x¥$œ€™ ø ¼@Ž €…|¥$œ€™ ø ¼ @&Ž”ÿ@éþ¢÷ÿ$$C¢¯òÿ¢B4¢¯ëÿ¢$Q¢¯äÿ¢B4¢¯Ýÿþÿ$Ž €…ø ¥$œ€™ ø ¼{@Ž €…d¥$œ€™ ø ¼n@Ž €…ü ¥$œ€™ ø ¼Z@Ž €…$¥$œ€™ ø ¼M@Ž €…h¥$œ€™ ø ¼9@Ž €…l¥$œ€™ ø ¼,@Ž €…x¥$œ€™ ø ¼@Ž €…|¥$œ€™ ø ¼ @&Ž”ÿ@[þ¢÷ÿ$$C¢¯òÿ¢B4¢¯ëÿ¢$Q¢¯äÿ¢B4¢¯Ýÿ¢ €…l¥$B0S@ €„ˆ„$ô€™ ø ¼¢ €…œ¥$B0<@ €„¤„$ô€™ ø ¼¢ €…œ¥$B0%@ €„¬„$ô€™ ø ¼¢ €…œ¥$B0@ €„¸„$ô€™ ø ¼þ! €…À¥$ðÿ €…À¥$Ùÿ €…À¥$Âÿ €…|¥$«ÿÀ<"œ'!à™¸ÿ½'¼¯,³¯(²¯$±¯@¿¯!ˆ€<¼¯8¶¯4µ¯0´¯ °¯0Ž €†ÌÆ$€ÀÄ€¢£££¤£! !˜ D€™ ø ¼ûÿC$>b,r&-@€ €ƒèc$!bcŒ!|`! D€™ ø ¼b®! @!(ü€™ ø ¼cŽ $$b! b,$ˆ@! $$b! ÿÿ$@¿8¶4µ0´,³(²$± °H½'àpb®tbŽ1&B4#Žtb®D`$$$ýÿ$%Ž €„Є$$À€™ ø ¼Q@%Ž €„Ô„$$À€™ ø ¼:@%Ž €„Ø„$$À€™ ø ¼%@œp&$Ž!(€™:9' ø ¼ @! 1&"ŽÄÿ@§ÿ!!($Œ€™ ø ¼1&îÿtbŽ$Ttb®æÿbŽÅÿRpu®ÝÿbŽ®ÿRpv®Ôÿ$Šÿb! $$xÿb! pb®‚ÿ! D€™ ø ¼Bb®‚Vÿ@¤'!($ €™ ø ¼¤'!($Ѐ™ ø ¼!@b &‚R&çÿ@8ÿ!  €…à¥$$À€™ ø ¼!@&ÿÿ$8ÿ`Ãÿ! À<”œ'!à™Àÿ½'¼¯0´¯(²¯$±¯8¿¯4¼¯,³¯ °¯ÂŒ!€!ˆ  @! ! @H€™ ø ¼ %Ž! @¦'$¢¯\€™ ø ¼! @!€8¿0´,³(²$± °@½'à!€$%Ž! @¦'$°¯`€™ ø ¼!@ÿÿ$æÿ`¢S!(&*èÿ@ €„à„$à€™ ø ¼Ðÿ!€ €„ô„$ô€™ ø ¼Äÿ!À<œ'!à™(ÿ½'¼¯Ä±¯À°¯±'!€À̳¯È²¯&!€!˜ ! ¤$!(Ô¿¯Ð¼¯Œ€™ ø ¼Žÿÿ$&`! `H€™ ø ¼¢¯Ž!( $@! €™Ht9' ø ¼!@!0 ÿÿ$¤$ `! @Կ̳ȲıÀ°Ø½'à eŽ\€™ ø ¼ïÿ €„„$à€™ ø ¼ÿÿ$âÿÀ<œœ'!à™(ÿ½'¼¯À°¯!€À̳¯È²¯!˜€! ¤'!(¤$&Ô¿¯Ð¼¯Ä±¯Œ€™ ø ¼Žÿÿ$0€&H€™ ø ¼Ž¢¯`´±'Ž!( €™:9' ø ¼&! !($@Žìÿ@ EŽ! `¦'¤$\€™ ø ¼Ô¿Ì³È²Ä±À°Ø½'àŒ€™ ø ¼áÿÀ<$œ'!à™Àÿ½'¼¯,³¯!˜À4µ¯0´¯<¿¯8¼¯(²¯$±¯ °¯s&bŽ!¨€y@!  ! @¥'!0¸€™ ø ¼!€@cŽ¢½C!ˆ.s&d@abŽ¨$I@Ø€™ ø ¼!ˆ@$&!(0®¤$Œ€™ ø ¼ 0&dŽ!(€™:9' ø ¼@!  …Ž!  !0 ¨$\€™ ø ¼<¿4µ0´,³(²$± °@½'à!($Œ€™ ø ¼dŽH€™ ø ¼"®Úÿp€‡çŒ €„0„$$$T€™ ø ¼ÿÿ$Òÿp€‡çŒ>$ €„H„$$T€™ ø ¼€† Æ$ÐŒÿÿ$#Ñ$!R& €…˜¥$'!0p€„„Œ'Ž €…Œ¥$´€™ ø ¼!€ &!€Ž1&ãÿp€…¥Œ $d€™ ø ¼‹ÿ!p€„„Œ&Ž´€™ ø ¼Þÿ!€ &!€Ž¥ÿ! €„ „$! ‘„ŒeŽœ€™ ø ¼Q&éÿ@!.*ÿ@! ÿÀ<$œ'!à™ÿ½'¼¯Ø´¯À¦'!  $*$Ô³¯à¿¯Ü¼¯Ð²¯Ì±¯È°¯À ¯!˜€`€™ ø ¼!@`!…Ž! `¦'¤$²¯`€™ ø ¼!@B.ø`Ð@!(@ €„ˆ„$ô€™ ø ¼ˆ£b,€@! €ƒ0c$!bcŒ!|` €„œ„$ô€™ ø ¼À¢ $@Œ¢B0*$@™ ø ¼ $™ ø ¼¥W  €„ „$ô€™ ø ¼£`!€ ±'%’ €„Œ„$ô€™ ø ¼£&+1&ñÿ@!€ ±'+@$’„€™ ø ¼1&@£&îÿ£ $ ™ ø ¼R&gÿ €„°„$ ¦'!(ô€™ ø ¼ $éÿ €„¸„$ô€™ ø ¼ $Üÿ €„È„$uÿ €„Є$oÿ €„Ø„$iÿ €„à„$cÿ €„è„$]ÿ €„ø„$ô€™ ø ¼Wÿµ£“´¢“¶¤“%C·¥“% ‚¸£“%(¤¹¢“%e%C´¤'©ÿ@€™ô:9' ø ¼¦ €„„$!(@ô€™ ø ¼ÿB.@!à¿Ø´Ô³Ð²Ì±È°!`è½'à €„„$à€™ ø ¼àþÀ<,œ'!à™Èÿ½'¼¯(²¯$±¯0¿¯,¼¯ °¯ÃŒ!ˆ€! ! `ÿÿ$`H€™ ø ¼!€@6.!(¦'! $@ €„L„$ô€™ ø ¼ÿÿ$0¿(²$± °8½'àEŽ°¯`€™ ø ¼!@ €„h„$ëÿ`!(§—¦ô€™ ø ¼àÿ!À<øœ'!à™Àÿ½'¼¯,±¯!ˆÀ4³¯0²¯<¿¯8¼¯(°¯1&0Ž!˜€!  €„„„$ €…ü ¥$B! œ€™ ø ¼4@! H€™ ø ¼¢¯#Ž$  ¯¢¯`! `H€™ ø ¼@ $¢¯C EŽ! `¦' $\€™ ø ¼<¿4³0²,±(°@½'à $¢¯êÿ ¯Óÿà€™ ø ¼ÿÿ$æÿÀ [ocb | ccm] [notx] [xx:xx:xx:xx:xx:xx]rmwepRemove the encryption key at the specified key index.wepSet WEP options. wl wep [options] [on|enable|1] enable WEP [off|disable|0] disable WEP [sw|software] perform WEP in software [hw|hardware] perform WEP in hardwaretkipSet TKIP options. wl tkip [options] [on|enable|1] enable TKIP [off|disable|0] disable TKIP [sw|software] perform TKIP in software [hw|hardware] perform TKIP in hardwareaesSet AES options. wl aes [options] [on|enable|1] enable AES [off|disable|0] disable AES [sw|software] perform AES in software [hw|hardware] perform AES in hardwarekeysPrints a list of the current WEP keystxivPrint Tx IV for key at specified key index.wsec_testGenerate wsec errors wsec_test type 'wl wsec_test ?' for test_typestkip_countermeasuresEnable or disable TKIP countermeasures (TKIP-enabled AP only) 0 - disable 1 - enablewsec_restrictDrop unencrypted packets if WSEC is enabled 0 - disable 1 - enableeaprestrict traffic to 802.1X packets until 802.1X authorization succeeds 0 - disable 1 - enableauthorizerestrict traffic to 802.1X packets until 802.1X authorization succeedsdeauthorizedo not restrict traffic to 802.1X packets until 802.1X authorization succeedsdeauthenticatedeauthenticate a STA from the AP with optional reason code (AP ONLY)wsecwireless security bit vector 1 - WEP enabled 2 - TKIP enabled 4 - AES enabled 8 - WSEC in softwarewpa_authWPA authorization mode [none|0] none [unspecified|1] WPA 802.1X [psk|2] WPA PSK [disable|255] disable WPAscanInitiate an active scan across all channels. Optional SSID argument specifies a particular SSID to scan. With no SSID argument, a broadcast SSID scan is performed.passivePuts scan engine into passive moderegulatoryGet/Set regulatory domain mode (802.11d). Driver must be down.spectGet/Set 802.11h Spectrum Management mode.scanresultsReturn results from last scan.assocPrint information about current network association. (also known as "status")statusPrint information about current network association. (also known as "assoc")disassocDisassociate from the current BSS/IBSS.chanlistReturn valid channels for the current settings.channelschannels_in_countryReturn valid channels for the country specified. Arg 1 is the country abbreviation Arg 2 is the band(a or b)curpowerReturn current tx power settingsscansuppressSuppress all scans for testing. 0 - allow scans 1 - suppress scansevmStart an EVM test on the given channel, or stop EVM test. Arg 1 is channel number 1-14, or "off" or 0 to stop the test. Arg 2 is optional rate (1, 2, 5.5 or 11)ratesetReturns or sets the supported and basic rateset, (b) indicates basic With no args, returns the rateset. Args are rateset "default" | "all" | default - driver defaults all - all rates are basic rates arbitrary rateset - list of rates List of rates are in Mbps and each rate is optionally followed by "(b)" or "b" for a Basic rate. Example: 1(b) 2b 5.5 11 At least one rate must be Basic for a legal rateset.roam_triggerSet the roam trigger RSSI threshold. (integer)roam_deltaSet the roam candidate qualification delta. (integer)roam_scan_periodsupratesReturns or sets the 11g override for the supported rateset With no args, returns the rateset. Args are a list of rates, or 0 or -1 to specify an empty rateset to clear the override. List of rates are in Mbps, example: 1 2 5.5 11scan_channel_timeGet/Set scan channel timescan_unassoc_timeGet/Set unassociated scan channel dwell timescan_home_timeGet/Set scan home channel dwell timescan_passive_timeGet/Set passive scan channel dwell timescan_nprobesGet/Set scan parameter for number of probes to use per channel scannedprb_resp_timeoutGet/Set probe response timeoutchannel_qaGet last channel quality measurmentchannel_qa_startStart a channel quality measurmentcountrySelect Country code for use with 802.11d Use either long name or abbreviation from ISO 3166. Use 'wl country list' for the complete list.localeOBSOLETE: use "wl country" Select the country: Worldwide Thailand Israel Jordan China Japan USA/Canada/ANZ Europe USAlow JapanHigh AlljoinJoin a specified network SSID. Join syntax is: join [key xxxxx] [imode bss|ibss] [amode open|shared]ssidSet or get the current SSID. Setting will initiate an assoication attempt if in infrastructure mode, or join/creation of an IBSS if in IBSS mode, or creation of a BSS if in AP mode.macSet or get the list of source MAC address matches. wl mac xx:xx:xx:xx:xx:xx [xx:xx:xx:xx:xx:xx ...] To Clear the list: wl mac nonemacmodeSet the mode of the MAC list. 0 - Disable MAC address matching. 1 - Deny association to stations on the MAC list. 2 - Allow association to stations on the MAC list.wdsSet or get the list of WDS member MAC addresses. Set using a space separated list of MAC addresses. wl wds xx:xx:xx:xx:xx:xx [xx:xx:xx:xx:xx:xx ...]lazywdsSet or get "lazy" WDS mode (dynamically grant WDS membership to anyone).noiseGet noise (moving average) right after tx in dBmfqacurcyManufacturing test: set frequency accuracy mode. freqacuracy syntax is: fqacurcy Arg is channel number 1-14, or 0 to stop the test.crsuprsManufacturing test: set carrier suppression mode. carriersuprs syntax is: crsuprs Arg is channel number 1-14, or 0 to stop the test.intInterrupt Test - remember to precede by 'wl down' and follow by 'wl up'lbtLoopback Test - remember to precede by 'wl down' and follow by 'wl up'bandReturns or sets the current band auto - auto switch between available bands (default) a - force use of 802.11a band b - force use of 802.11b bandbandsReturn the list of available 802.11 bandsphylistReturn the list of available phytypesshortslotGet/Set 11g Short Slot Timing mode. (-1=auto, 0=long, 1=short)shortslot_overrideGet/Set 11g Short Slot Timing mode override. (-1=auto, 0=long, 1=short)shortslot_restrictGet/Set AP Restriction on associations for 11g Short Slot Timing capable STAs. 0 - Do not restrict association based on ShortSlot capability 1 - Restrict association to STAs with ShortSlot capabilityignore_bcnsAP only (G mode): Check for beacons without NONERP element (0=Examine beacons, 1=Ignore beacons)pktcntGet the summary of good and bad packets.upgradeUpgrade the firmware on an embedded devicegmodeSet the 54g Mode (LegacyB|Auto||GOnly|BDeferred|Performance|LRS|Afterburner)gmode_protectionGet G protection mode. (0=disabled, 1=enabled)gmode_protection_controlGet/Set 11g protection mode control alg. (0=always off, 1=monitor local association, 2=monitor overlapping BSS)gmode_protection_ctsGet/Set 11g protection type to CTS (0=disable, 1=enable)gmode_protection_overrideGet/Set 11g protection mode override. (-1=auto, 0=disable, 1=enable)legacy_erpGet/Set 11g legacy ERP inclusion (0=disable, 1=enable)scb_timeoutAP only: inactivity timeout value for authenticated stasassoclistAP only: Get the list of associated MAC addresses.rssiGet the current RSSI val, for an AP you must specify the mac addr of the STAisupGet driver operational state (0=down, 1=up)fasttimerGet/Set High frequency watchdog timeout (tx_power) [15 sec]slowtimerGet/Set Low frequency watchdog timeout (nrssislope) [60 sec]glacialtimerGet/Set Very Low frequency watchdog timeout (measurelo) [120 sec]radarEnable/Disable radarrssidumpDump rssi values from aci scansinterferenceGet/Set interference mitigation mode. Choices are: 0 = none 1 = non wlan 2 = wlan manual 3 = wlan automaticaciargsGet/Set various aci tuning parameters. Choices are: enter: CRS glitch trigger level to start detecting ACI exit: CRS glitch trigger level to exit ACI mode glitch Seconds interval between ACI scans when glitchcount is continuously high spin: Num microsecs to delay between rssi samples Usage: wl aciargs [enter x][exit x][spin x][glitch x]frameburstDisable/Enable frameburst modepwr_percentGet/Set power output percentagewetGet/Set wireless ethernet bridging modedtimGet/Set DTIMpeer_macGet WDS peer MAC addresswpa_supmeasure_reqSend an 802.11h measurement request. Usage: wl measure_req Measurement types are: TPC, Basic, CCA, RPI Target MAC addr format is xx:xx:xx:xx:xx:xxquietSend an 802.11h quiet command. Usage: wl quiet , , csaSend an 802.11h channel switch anouncement Usage wl csa constraintSend an 802.11h Power Constraint IE Usage: wl constraint 1-255 db%s %s %s %s Usage: wl [-a|i ] [-hu] [arguments] -a, -i adapter name or number -h, -u this message varunrecognized name, type -h for helpVersion mismatch, please upgrade onoff%s is %d %s is %d(0x%x) %s is 1 (on) %s is 0 (off) legacyautogonlyperflrsafterburner54g Legacy B54g Mode is %s (%d) 54g Auto54g Onlyunknown54g Performance54g LRS54g AfterburnerÜ‚?ðƒ?ð0ƒ?ðHƒ?ð`ƒ?ðxƒ?ðƒ?ð%s is 0x%04x %s at offset 0x%x is 0x%04x %s is %s Failed to allocate dump buffer of %d bytes srom[%03d]: 0x%04x unknown locale: %s Current locale is unknown: %d errorerrtraceprhdrsprpktinforminfoinftmpoidasprusrpspwrdualwsec_dumplognrssiloftacimsg values may be a list of numbers or names from the following set: 0x%04x %s, %s%s is 0x%x -15.5.5%s is %d%s Mbps %s is auto alldefaultBad Args: at least one rate must be marked Basic %s : 0Warning: Basic rate attribute ignored for "%s" command b(b)unable to convert trailing characters "%s" in the rate parameter "%s" unable to convert the rate parameter "%s" parsing "%s", too many rates specified, max is %d rates Scan in progress.current scan channel %d current mac channel %d target channel %d No scan in progress.%02X\x%02Xlongdebug%s is off (WL_RADIO_SW_DISABLE %d WL_RADIO_HW_DISABLE %d) on %d/%d/%d build %d%d.%d RC%d.%dwl: %s %s SSID arg "%s" must be 32 chars or less [ %d%s%s ManagedAd HocAutoPòWSEC->WPA multicast: Pòunitcase cipher: NONE WEP1 TKIP AES OCB AES CCM WEP128 NONE WEP1 TKIP AES OCB AES CCM WEP128 4·?ðd·?ð”·?ðÄ·?ðô·?ð$¸?ð ¸?ðи?ð¹?ð0¹?ð`¹?ð¹?ðSorry, your driver has bss_info_version %d but this program supports only version %d and %d SSID: "%s"Mode: %s RSSI: %d dBm noise: %d dBm Channel: %dBSSID: %s Capability: ESS IBSS Pollable PollReq WEP ShortPre PBCC Agility ShortSlot CCK-OFDM Supported Rates: User Target: %6.2f dB Regulatory Max: %6.2f dB Regulatory Constraint: %6.2f dB Current Limit: %6.2f dB valid channels: %dinvalid country abbrev: %s aunsupported band: %s missing bandmissing country abbrevNot associated. Last associated with SSID: "%s" Malformed STA MAC parameterSTA MAC must be specifiednoneunspecifiedpskdisable%s is not a valid WPA auth mode IllegalWPA auth mode %s (%d) 1swsoftwarehwhardwareAlgorithms (%s): enabledWEP %s TKIP %s AES %s disabledXXccmocbnotx0x´Þ?ð4ß?ð4ß?ð4ß?ð4ß?ðlá?ð4ß?ðâ?ð´Þ?ð4ß?ð4ß?ð´Þ?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ðlá?ð4ß?ðâ?ð4ß?ð4ß?ð4ß?ðlá?ð4ß?ðâ?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ð4ß?ðlá?ð4ß?ðâ?ðNo primary key setKey %d is primary No key specifiedmic_errorreplayinsufficient arguments wsec test_type may be a number or name from the following set:(default) Key %d: Offlen %d, data 0x (%.*s)No key presentWEP1TKIPWEP128AES CCMAES OCB MSDUAES OCB MPDU%s Key %d: Could not query wep status.ì?ð(î?ð@î?ðXî?ðpî?ðˆî?ð î?ðKey index %d out of range. Key %d Tx IV: 0x%08x%04x Need to specify at least one parameterwepkeykeyimodemodeamodeauthopensharedibssadhocad-hocbssmanagedSetting SSID "%s" Current SSID: "%s" %s: CCK %d, OFDM %d (auto) Current 11b/g tx atten is%sbb/radio/ctl1 = %d/%d/%d clearProblem parsing MAC address "%s". %s %s Failed %s %s passed unrecognized band value %d a ? b %c rbProgramming %s... error reading %s Committing image to flash... *** UPGRADE FAILED! *** (status %ld) Done Successfully downloaded %d bytes %s: No such file or directory Receive: good packet %d, bad packet %d Transmit: good packet %d, bad packet %d ACI is ActiveChannel %d : %d Got a -1ACI is InactiveAll interference mitigation is disabled.Auto Wireless LAN Interference mitigation is enabled and activenot activeWireless LAN Interference mitigation is enabled.Non-wireless LAN Interference mitigation is enabled.listParameter "%s" was unrecognized as a country name, and is too long for a max 3 character country abbreviation. Setting country code "%s" Setting country "%s" failed Supported long names and abbreviations:%s %s %s/%s No country setenterexitspinglitchNeed to specify a valueCannot set ACI argsInvalid value for %s Bad parameter specificationCannot get ACI args for settingGlitch count to enter ACI scan mode: %d Glitch count to exit ACI mode: %d Usecs to spin between rssi samples : %d Interval (in seconds) for ACI scanning in presence of high glitch count: %d Cannot get ACI argsaci_args.enter_aci_thresh = %d Cannot get peer WPA supplicant statusWPA supplicant: %s(%d) yesnoCannot get peer hwaddrtpcbasicccarpierror: unknown measurement type %s error: could not parse MAC address %s error: missing target addresserror: missing argumentsvendorid: %x deviceid: %x radiorev: %x chipnum: %x chiprev: %x corerev: %x boardid: %x boardvendor: %x boardrev: %x driverrev: %x ucoderev: %x bus: %x set: error parsing value "%s" as an integer for set of "%s" set: missing value argument for set of "%s" set: missing argumentsgetget: error, extra arg "%s" get: missing argumentsnvdump error: extra arg "%s" nvget: missing argumentsnvget error: extra arg "%s" nvset: missing argumentsnvset error: extra arg "%s"; format is name=value (no spaces around '=') nvset error: no '=' in "%s", format is name=value (no spaces around '=') AFGHANISTANAFALBANIAALALGERIADZAMERICAN SAMOAASANDORRAADANGOLAAOANGUILLAAIANTARCTICAAQANTIGUA AND BARBUDAAGARGENTINAARARMENIAAMARUBAAWAUSTRALIAAUAUSTRIAATAZERBAIJANAZBAHAMASBSBAHRAINBHBANGLADESHBDBARBADOSBBBELARUSBYBELGIUMBEBELIZEBZBENINBJBERMUDABMBHUTANBTBOLIVIABOBOSNIA AND HERZEGOVINABABOTSWANABWBOUVET ISLANDBVBRAZILBRBRITISH INDIAN OCEAN TERRITORYIOBRUNEI DARUSSALAMBNBULGARIABGBURKINA FASOBFBURUNDIBICAMBODIAKHCAMEROONCMCANADACACAPE VERDECVCAYMAN ISLANDSKYCENTRAL AFRICAN REPUBLICCFCHADTDCHILECLCHINACNCHRISTMAS ISLANDCXCOCOS (KEELING) ISLANDSCCCOLOMBIACOCOMOROSKMCONGOCGCONGO, THE DEMOCRATIC REPUBLIC OF THECDCOOK ISLANDSCKCOSTA RICACRCOTE D'IVOIRECICROATIAHRCUBACUCYPRUSCYCZECH REPUBLICCZDENMARKDKDJIBOUTIDJDOMINICADMDOMINICAN REPUBLICDOECUADORECEGYPTEGEL SALVADORSVEQUATORIAL GUINEAGQERITREAERESTONIAEEETHIOPIAETFALKLAND ISLANDS (MALVINAS)FKFAROE ISLANDSFOFIJIFJFINLANDFIFRANCEFRFRENCH GUIANAGFFRENCH POLYNESIAPFFRENCH SOUTHERN TERRITORIESTFGABONGAGAMBIAGMGEORGIAGEGERMANYDEGHANAGHGIBRALTARGIGREECEGRGREENLANDGLGRENADAGDGUADELOUPEGPGUAMGUGUATEMALAGTGUINEAGNGUINEA-BISSAUGWGUYANAGYHAITIHTHEARD ISLAND AND MCDONALD ISLANDSHMHOLY SEE (VATICAN CITY STATE)VAHONDURASHNHONG KONGHKHUNGARYHUICELANDISINDIAININDONESIAIDIRAN, ISLAMIC REPUBLIC OFIRIRAQIQIRELANDIEISRAELILITALYITJAMAICAJMJAPANJPJORDANJOKAZAKHSTANKZKENYAKEKIRIBATIKIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKPKOREA, REPUBLIC OFKRKUWAITKWKYRGYZSTANKGLAO PEOPLE'S DEMOCRATIC REPUBLICLALATVIALVLEBANONLBLESOTHOLSLIBERIALRLIBYAN ARAB JAMAHIRIYALYLIECHTENSTEINLILITHUANIALTLUXEMBOURGLUMACAOMOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMKMADAGASCARMGMALAWIMWMALAYSIAMYMALDIVESMVMALIMLMALTAMTMARSHALL ISLANDSMHMARTINIQUEMQMAURITANIAMRMAURITIUSMUMAYOTTEYTMEXICOMXMICRONESIA, FEDERATED STATES OFFMMOLDOVA, REPUBLIC OFMDMONACOMCMONGOLIAMNMONTSERRATMSMOROCCOMAMOZAMBIQUEMZMYANMARMMNAMIBIANANAURUNRNEPALNPNETHERLANDSNLNETHERLANDS ANTILLESANNEW CALEDONIANCNEW ZEALANDNZNICARAGUANINIGERNENIGERIANGNIUENUNORFOLK ISLANDNFNORTHERN MARIANA ISLANDSMPNORWAYNOOMANOMPAKISTANPKPALAUPWPALESTINIAN TERRITORY, OCCUPIEDPSPANAMAPAPAPUA NEW GUINEAPGPARAGUAYPYPERUPEPHILIPPINESPHPITCAIRNPNPOLANDPLPORTUGALPTPUERTO RICOPRQATARQAREUNIONREROMANIARORUSSIAN FEDERATIONRURWANDARWSAINT HELENASHSAINT KITTS AND NEVISKNSAINT LUCIALCSAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESVCSAMOAWSSAN MARINOSMSAO TOME AND PRINCIPESTSAUDI ARABIASASENEGALSNSEYCHELLESSCSIERRA LEONESLSINGAPORESGSLOVAKIASKSLOVENIASISOLOMON ISLANDSSBSOMALIASOSOUTH AFRICAZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSGSSPAINESSRI LANKALKSUDANSDSURINAMESRSVALBARD AND JAN MAYENSJSWAZILANDSZSWEDENSESWITZERLANDCHSYRIAN ARAB REPUBLICSYTAIWAN, PROVINCE OF CHINATWTAJIKISTANTJTANZANIA, UNITED REPUBLIC OFTZTHAILANDTHTIMOR-LESTETLTOGOTGTOKELAUTKTONGATOTRINIDAD AND TOBAGOTTTUNISIATNTURKEYTRTURKMENISTANTMTURKS AND CAICOS ISLANDSTCTUVALUTVUGANDAUGUKRAINEUAUNITED ARAB EMIRATESAEUNITED KINGDOMGBUNITED STATESUSUNITED STATES MINOR OUTLYING ISLANDSUMURUGUAYUYUZBEKISTANUZVANUATUVUVENEZUELAVEVIET NAMVNVIRGIN ISLANDS, BRITISHVGVIRGIN ISLANDS, U.S.VIWALLIS AND FUTUNAWFWESTERN SAHARAEHYEMENYEYUGOSLAVIAYUZAMBIAZMZIMBABWEZWÿÿÿÿÿÿªªLsocketr/proc/net/dev:-a-i-h-uWrong command, type -h for help wl driver adapter not found dÐÖ@ÜÖ@èÖ@ðÖ@øÖ@×@ ×@×@×@ ×@$×@0×@4×@<×@D×@P×@`×@ (0<D\d l t |h×@üB@ÿÿÿÿÿÿÿÿl×@„×@T@ÿÿÿÿˆ×@¸×@T@ÿÿÿÿÀ×@è×@@ÿÿÿÿ£ì×@\Ø@À@ ¡`Ø@ÐØ@T@ÿÿÿÿØØ@Ù@T@ÿÿÿÿ Ù@ Ù@À@¦§(Ù@<Ù@Ä?@%&DÙ@lÙ@˜ @ÿÿÿÿtÙ@°Ù@(#@Oÿÿÿÿ¸Ù@ÜÙ@ÜÄ@ ÿÿÿÿäÙ@Ú@ŒÈ@ÿÿÿÿ  Ú@HÚ@ðÆ@ÿÿÿÿPÚ@tÚ@ô½@bÿÿÿÿ|Ú@ Ú@(@¬Ú@üÚ@À@UVÛ@TÛ@À@WX\Û@ Û@À@ ¨Û@ôÛ@À@klüÛ@XÜ@À@`Ü@œÜ@À@ Ü@ÌÜ@À@âãÔÜ@øÜ@À@äåÝ@(Ý@À@ ,Ý@\Ý@À@!"`Ý@Ý@l+@ ˜Ý@ Þ@@-@™š¨Þ@¸ß@À@Àß@ôß@À@uvøß@à@P@ÿÿÿÿ à@Xà@ 8@`à@|á@|“@ªÿÿÿÿ„á@¤á@<”@AB¬á@Øá@À@ƒ„äá@â@À@¨© â@`â@¤•@ÂÃhâ@Ðâ@@^_Øâ@ðâ@@`aüâ@ã@@ÄÅ ã@Dã@ä@efLã@œã@À@?@¤ã@(ä@À@=>0ä@ðä@=@#$øä@,å@À@'ÿÿÿÿ4å@Då@˜ @ÿÿÿÿLå@på@Ì!@(ÿÿÿÿ|å@èå@8D@ÿÿÿÿ)ôå@@æ@À@*+Læ@xæ@Ìx@ëì„æ@¤æ@\z@ÿÿÿÿ-¬æ@8è@Ä{@ÿÿÿÿ-@è@xè@œj@…†|è@$é@œj@…†,é@Üé@œj@…†àé@ˆê@<@,ÿÿÿÿê@¸ê@4†@·ÿÿÿÿÀê@ìê@<}@ÿÿÿÿÈøê@hë@À@ÿÿÿÿÊ€ë@Øë@À@QRèë@0ì@À@wx4ì@”ì@P@ÿÿÿÿy ì@èì@P@ÿÿÿÿzôì@Dí@f@ÿÿÿÿÉTí@œí@À@…†¤í@ î@|g@¤¥î@ˆî@ E@ÿÿÿÿ2î@8ï@À@01@ï@dï@À@./pï@°ï@À@õô¸ï@äï@4\@3ÿÿÿÿðï@ð@Äc@ÿÿÿÿÿÿÿÿð@hð@Äc@ÿÿÿÿÿÿÿÿpð@Àð@T@ÿÿÿÿ4Ìð@ôð@ˆ^@Ùÿÿÿÿñ@0ñ@ˆ^@Ùÿÿÿÿñ@<ñ@À_@ÿÿÿÿPñ@Àñ@ì\@ÿÿÿÿÌñ@ðñ@À@stò@Hò@h‡@ÿÿÿÿ<Lò@ðò@X/@GHøò@°ô@À@67Àô@ðô@À@89üô@4õ@À@:;üô@Hõ@¨2@«¬Tõ@<ö@À@¸¹Pö@lö@À@º»€ö@°ö@À@¼½Àö@èö@À@üö@$÷@À@¾¿4÷@|÷@À@ÀÁ÷@°÷@À@Õÿÿÿÿ¼÷@à÷@T@ÿÿÿÿÖô÷@ø@È®@ST ø@¬ø@ $@IJ´ø@Hù@ôˆ@ÿÿÿÿÿÿÿÿPù@Àù@@‘@Èù@„ú@\˜@EFˆú@û@À@ijû@Àû@\˜@{|Äû@\ü@À@Š‹dü@°ü@À@‡ÿÿÿÿ¸ü@ìü@À@ÿÿÿÿ\øü@ˆý@À@ÿÿÿÿ]ý@$þ@8œ@g(þ@pþ@8œ@gtþ@¼þ@h@ŽÄþ@\ÿ@ @Œÿÿÿÿdÿ@ÿ@€¡@´ÿÿÿÿ˜ÿ@Àÿ@À@ÿÿÿÿÌÿ@ AÀ@‘’ AhAÀ@“”|AHAÀ@›œTA¸A0¦@‰ÿÿÿÿÀAìAl¢@ÿÿÿÿ˜ôA A€@mn(AxAÀ@•ÿÿÿÿŒA¼AÀ@²³ØAHAÀ@ÆÇ`AœAÀ@–—¸AAÀ@op ADAÀ@žPAŒA\˜@Ÿÿÿÿÿ˜AÌAP@ÿÿÿÿÔA$AÀ@¢ÿÿÿÿ,AXAÀ@®­dA AÀ@°¯¬AìAÀ@êéüA@AÀ@òóHA`A<§@ ÿÿÿÿlAŒAè©@ÓÔœA At²@îïApAÀ@ÚÛ|AœAÀ@ÜݨAÈAÀ@æçÌAôAÀ@MNüA AP@öÿÿÿÿ A4 A<·@÷ÿÿÿÿ A< A˜¸@ÿÿÿÿúH Aø Ad»@ÿÿÿÿü Ap A¬¼@ÿÿÿÿýt AÔ AÀ@ÿÿÿÿþà A¬ AXÆ@ÿÿÿÿÿÿÿÿ° AÄ AÌ AÐ AØ Aà Aè Að Aø A ü A@A€Ý@ð@AAA¤á@A A A@œí@€ A,A0A8Adï@@A @Al q v { € … Š  ” ™ ž £ ¨ ´ $<(P,d0x4Œ8 <´@Èd|hl¤p¸tÌxà|ô€„ˆ0ŒD•q™…™¡­¸8¼LÀ`ÄtȈÌœаÔÄØØhA`A|AAAAÿAA(At"A€"A„"AŒ"A"A˜"Aœ"A¬"A°"A¸"A¼"AÄ"AÈ"AÔ"AØ"Aä"Aè"Aü"A#A #A#A#A#A$#A(#A4#A8#A@#AD#AP#AT#A\#A`#Ah#Al#Ax#A|#Aˆ#AŒ#A”#A˜#A #A¤#A¬#A°#A¸#A¼#AÄ#AÈ#AÐ#AÔ#AÜ#Aà#Aø#Aü#A$A $A$A $A($A,$AL$AP$Ad$Ah$At$Ax$Aˆ$AŒ$A”$A˜$A¤$A¨$A´$A¸$AÀ$AÄ$AÐ$AÔ$Aä$Aè$A%A%A%A%A%A %A(%A,%A@%AD%A\%A`%Al%Ap%Ax%A|%A„%Aˆ%A°%A´%AÄ%AÈ%AÔ%AØ%Aè%Aì%Aô%Aø%A&A&A &A&A &A$&A,&A0&A<&A@&AL&AP&Ad&Ah&Ap&At&A|&A€&AŒ&A&A¤&A¨&A°&A´&A¼&AÀ&AÌ&AÐ&Aì&Að&A'A'A 'A'A'A'A$'A('A8'A<'AP'AT'Ap'At'A|'A€'Aˆ'AŒ'A”'A˜'A 'A¤'A¬'A°'A¼'AÀ'AÈ'AÌ'AØ'AÜ'Aä'Aè'Aô'Aø'A(A(A(A(A(A (A0(A4(A<(A@(AH(AL(Ap(At(A”(A˜(A¤(A¨(A´(A¸(AÀ(AÄ(AÌ(AÐ(AØ(AÜ(Aè(Aì(A)A )A)A)A )A$)A,)A0)A8)A<)AD)AH)AP)AT)A\)A`)Al)Ap)Ax)A|)Aˆ)AŒ)A´)A¸)AÌ)AÐ)AØ)AÜ)Aè)Aì)A*A*A*A *A(*A,*A4*A8*A@*AD*A\*A`*Ap*At*A€*A„*A*A”*Aœ*A *AÌ*AÐ*AÜ*Aà*Aè*Aì*Aø*Aü*A+A +A+A+A +A$+A8+A<+AH+AL+AX+A\+Ah+Al+At+Ax+A€+A„+A¤+A¨+AÀ+AÄ+AÌ+AÐ+AÜ+Aà+Aì+Að+Aø+Aü+A,A ,A,A,A ,A$,A,,A0,A8,A<,AH,AL,Ad,Ah,Ax,A|,Aˆ,AŒ,A˜,Aœ,A¤,A¨,A°,A´,A¼,AÀ,AÐ,AÔ,Að,Aô,Aü,A-A-A -A-A-A$-A(-AH-AL-AT-AX-Al-Ap-A|-A€-Aˆ-AŒ-A˜-Aœ-A¨-A¬-A´-A¸-AÄ-AÈ-AÔ-AØ-Aà-Aä-Aì-Að-Aø-Aü-A.A.A.A .A0.A4.AL.AP.A\.A`.AüÚ@|.A .A¤.A¬.A°.A¼.AÀ.AØ.AÜ.Aì.Að.Aø.Aü.A/A /A/A /A,/A0/A